PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G72350.1
Common NameT10D10.18
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family M-type_MADS
Protein Properties Length: 224aa    MW: 25513.1 Da    PI: 9.355
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G72350.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF66.52.7e-215398449
                 -SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
       SRF-TF  4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                   +++rqvtfskRr g++KKA ELSvLC+a++ +i fs  +++y +
  AT1G72350.1 53 MLETRRQVTFSKRRSGLFKKAAELSVLCGAQIGIITFSRCDRIYSF 98
                 5579***********************************9999988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006625.0242102IPR002100Transcription factor, MADS-box
SMARTSM004324.2E-2642101IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.94E-2343111IPR002100Transcription factor, MADS-box
CDDcd002653.01E-3043109No hitNo description
PRINTSPR004041.0E-194464IPR002100Transcription factor, MADS-box
PfamPF003193.1E-215598IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-196479IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-1979100IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MEDGEASTIT FLPTTEPKPL QNPNLLAKPK KETKQKKPKT TKGRQKIEIK EIMLETRRQV  60
TFSKRRSGLF KKAAELSVLC GAQIGIITFS RCDRIYSFGN VNSLIDKYLR KAPVMLRSHP  120
GGNVANGEED NDGLMWWERA VESVPEEHME EYKNALSVLR ENLLTRIYQM SGDRTVENLP  180
AFPNEMAMAD WKLTNENLMA RNDRGYGGNN GDLEFAFMPQ NGRQ
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO184100600.0
Genevisible260452_at0.0
Expression AtlasAT1G72350-
AtGenExpressAT1G72350-
ATTED-IIAT1G72350-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G72350.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G72350
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0165290.0AC016529.7 Arabidopsis thaliana chromosome 1 BAC T10D10 genomic sequence, complete sequence.
GenBankAY1412350.0AY141235.1 Arabidopsis thaliana MADS-box protein AGL60 mRNA, complete cds.
GenBankBT0256470.0BT025647.1 Arabidopsis thaliana At1g72350 mRNA, complete cds.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
GenBankDQ4464210.0DQ446421.1 Arabidopsis thaliana clone pENTR221-At1g72350 MADS-box protein (At1g72350) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_177379.11e-168MADS-box transcription factor family protein
TrEMBLQ9C9D41e-168Q9C9D4_ARATH; At1g72350
STRINGAT1G72350.11e-167(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46972052
Representative plantOGRP1617761
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. De Bodt S, et al.
    Genomewide structural annotation and evolutionary analysis of the type I MADS-box genes in plants.
    J. Mol. Evol., 2003. 56(5): p. 573-86
    [PMID:12698294]
  3. Parenicov√° L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  4. Kofuji R, et al.
    Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses.
    Mol. Biol. Evol., 2003. 20(12): p. 1963-77
    [PMID:12949148]
  5. De Bodt S,Raes J,Van de Peer Y,Theissen G
    And then there were many: MADS goes genomic.
    Trends Plant Sci., 2003. 8(10): p. 475-83
    [PMID:14557044]
  6. Osuna D, et al.
    Temporal responses of transcripts, enzyme activities and metabolites after adding sucrose to carbon-deprived Arabidopsis seedlings.
    Plant J., 2007. 49(3): p. 463-91
    [PMID:17217462]